General Information

  • ID:  hor004780
  • Uniprot ID:  A0A0A0R4U6(44-56)
  • Protein name:  Ranakinin-MS2
  • Gene name:  NA
  • Organism:  Sylvirana maosonensis (Mo-Son frog)
  • Family:  Bradykinin-related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sylvirana (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RAEPVPPGFTPFR
  • Length:  13(44-56)
  • Propeptide:  MFTLKKSLLLLFFLGTISLSLCEEERDADEEETEGEAKMENFKRAEPVPPGFTPFREP
  • Signal peptide:  MFTLKKSLLLLFFLGTISLSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Elicit concentration-dependent contraction of isolated rat ileum
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0A0R4U6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004780_AF2.pdbhor004780_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 168489 Formula: C69H103N19O17
Absent amino acids: CDHIKLMNQSWY Common amino acids: P
pI: 10.4 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -64.62 Boman Index: -2647
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 30
Instability Index: 8330.77 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  30008150
  • Title:  Identification and Functional Analysis of Novel Bradykinin-Related Peptides (BRPs) From Skin Secretions of Five Asian Frogs